/eh/2025-01-08/173633966714069467/picture.png)
/eh/2024-12-24/173503345348979036/Favorite-Icon.png){kind=icon}
/eh/2025-07-08/1751962110204480194/picture.png)
/eh/2025-06-21/1750485478958537574/countryInfoIcon.png)
/eh/2025-06-21/1750485741321434291/Hi-Sign-in-My-Nihao.png)
/eh/2025-06-21/1750485837193896318/cart.png)
/eh/2025-06-21/1750485968202533847/cart.png)
/eh/2025-04-17/1744862476612819675/hot-img.png)
/eh/2025-11-07/1762504524550532584/header-icon.jpg){kind=icon}
/eh/2025-07-07/1751875582852206790/header-icon.png){kind=icon}
/eh/2025-07-07/1751875587886277738/header-icon.png){kind=icon}
L-glutathione | 70-18-8
US$ 24.37
download picture
Shopping security
product description
Why choose thelockerguy wholesale?
bpc 157 injection uk Buy BPC-157 b-12-all
Lipo-B12 Injections (MIC-B12) | Fat Metabolism & Energy Booster | Livea
Peptide Name: Vasoactive Intestinal Peptide (VIP) Sequence: HSDAVFTDNYSRVRSRFLEYSCRKRKQQ-NH₂ Length: 28 amino acids Molecular Weight: ~3,327 Da Receptor Targets: VPAC1, VPAC2 (Class B GPCRs) Purity: ≥98% (HPLC verified) Format: Lyophilized powder, 10mg vial Use: For laboratory research only, not for clinical or diagnostic use VIP Nasal Spray peptide Storage & Handling All peptides are supplied as sterile, lyophilized powder and are stable when handled correctly
b-12-all
Volume:5mg – 5 vial lab pack (Save 5%)
Throw away any expired or unused medication as directed by your healthcare provider or pharmacist
bpc 157 injection uk Buy BPC-157 b-12-all
Item no
:
25799161682
US$ 25.21
Pay in 4 interest-free payments of $6.30 Learn more
Min. order:
1piece
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Oct 14 - Oct 19
US$40
Get nowSign up to your membership to get coupons up to
15%
Get nowOpportunity to enjoy order discount up to 15% off
Please add the products
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
Frequently Asked Questions for bpc 157 injection uk Buy BPC-157 b-12-all
Does saving a product to a wish list reserve it?
Check whether sharing the list exposes information you prefer private. Confirm the exact product reference if several similar entries appear.
What should I record if a purchase-related problem happens only sometimes?
Check the seller's instructions before attempting any recommended observation steps. Update the existing case when you have meaningful new observations.
What should I compare when the same seller offers a product through different channels?
Check whether availability differs between the two channels. Avoid placing duplicate orders while deciding between the two offers.
You may also like
High Dose L-Glutathione (200MG/ML)
US$ 23.42
L-Glutathione reduced
US$ 20.77
Solaray®
US$ 28.19
Cymbiotika Liposomal Glutathione
US$ 22.85
Glutathione
US$ 27.60